| Entry | D8R8K6 |
Entry Name | D8R8K6_SELML |
| Sequence Status | unreviewed |
| Protein Name | Uncharacterized protein (Fragment) |
| Sequence Length | 150 |
| Gene Name | SELMODRAFT_86646 |
| Organism | Selaginella moellendorffii (Spikemoss) |
| EC Number | |
Protein Function | |
Pathway | |
Protein Active Site | |
Reference | 21551031 |
Domain | |
Motif | |
Protein Family | |
Ensembl ID | EFJ32079; |
Biocyc ID | PF01397; |
Protein Existence | Predicted |
Subunit Structure | |
Gene Ontology Biological Process | metabolic process [GO:0008152] |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; terpene synthase activity [GO:0010333]; metabolic process [GO:0008152] |
Gene Ontology Molecular Function | terpene synthase activity [GO:0010333] |
GO ID | GO:0008152; GO:0010333; GO:0016021 |
String Database | |
PDB | |
RefSeq | XP_002967480.1; |
KEGG | smo:SELMODRAFT_86646; |
InterPro | IPR001906;IPR036965;IPR008930; |
Protein Sequence | RIPLDKLHSVPRTLLYSLEGLQDLEIDWQKILKLQSKDGSFLSSLSSTACVYLKTKDRKSLQYLQNAMEDQNYAVPCHYPIDLFESLWVIDTIERLGIDVFFRDEIKAVLDYVYRYNALVLMILTKLFYLCLYQLLDKRRNRMGIYMLSQ |
