| Entry | G7JCQ4 |
Entry Name | G7JCQ4_MEDTR |
| Sequence Status | unreviewed |
| Protein Name | Amino-terminal domain terpene synthase |
| Sequence Length | 349 |
| Gene Name | 11409800 MTR_4g094020 |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| EC Number | |
Protein Function | |
Pathway | |
Protein Active Site | |
Reference | 22089132; 24767513; |
Domain | |
Motif | |
Protein Family | |
Ensembl ID | AES90629; |
Biocyc ID | |
Protein Existence | Predicted |
Subunit Structure | |
Gene Ontology Biological Process | metabolic process [GO:0008152] |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; terpene synthase activity [GO:0010333]; metabolic process [GO:0008152] |
Gene Ontology Molecular Function | terpene synthase activity [GO:0010333] |
GO ID | GO:0008152; GO:0010333; GO:0016021 |
String Database | |
PDB | |
RefSeq | XP_003608432.1; |
KEGG | mtr:MTR_4g094020; |
InterPro | IPR036965;IPR008930; |
Protein Sequence | MVYKCDAYFMHFSYVPNSTFIDLLILKPRRYSNIYGFFSPSLHPTFPPNKSSTILEIKVSKPLHAYCSFYNKTNLTIALNKIHISQSGKGKDDLRIRHAKALELSIEYQFEQEIEATFEAMLRFNGIQKNKYEGLSQVAFQFRMLRQKSFLGQKGWNSKDHYCLNPSKPSNEAFQLFHNLCLLSSGKTVYIGPASAASEVRINFFAFNGFPCPSLQNPSDHLLKTINKDFDQDIETGTGTMTAEEATCILVSSYKSSKMNQDVHNEVALLSIKVHFVSMLVLIQRSSVNMFRDLGYYRFSTTYNCAFYLSLFQDRGSLLSFIFGFITFMSIGGFPSFVEDMKIITKTIP |
