| Entry | J9QS25 |
Entry Name | MTS26_SELML |
| Sequence Status | reviewed |
| Protein Name | (E)-2-epi-beta-caryophyllene synthase (EC 4.2.3.137) (Microbial Terpene synthase-like protein 26) (SmMTPSL26) |
| Sequence Length | 367 |
| Gene Name | SELMODRAFT_414574 |
| Organism | Selaginella moellendorffii (Spikemoss) |
| EC Number | 4.2.3.137 |
Protein Function | FUNCTION: Sesquiterpene synthase converting farnesyl diphosphate to (E)-2-epi-beta-caryophyllene as the major product, and to two other unidentified sesquiterpenes. Has no diterpene synthase activity. {ECO:0000269|PubMed:22908266}. |
Pathway | PATHWAY: Secondary metabolite biosynthesis; terpenoid biosynthesis. |
Protein Active Site | |
Reference | 22908266; 21551031 |
Domain | DOMAIN: The Asp-Asp-Xaa-Xaa-Asp/Glu (DDXXD/E) motif is important for the catalytic activity, presumably through binding to Mg(2+). {ECO:0000250}. |
Motif | MOTIF 93 97 DDXXE motif. |
Protein Family | Terpene synthase family |
Ensembl ID | |
Biocyc ID | |
Protein Existence | Evidence at protein level |
Subunit Structure | |
Gene Ontology Biological Process | terpenoid biosynthetic process [GO:0016114] |
Gene Ontology Cellular Component | |
Gene Ontology | lyase activity [GO:0016829]; metal ion binding [GO:0046872]; terpenoid biosynthetic process [GO:0016114] |
Gene Ontology Molecular Function | lyase activity [GO:0016829]; metal ion binding [GO:0046872] |
GO ID | GO:0016114; GO:0016829; GO:0046872 |
String Database | |
PDB | |
RefSeq | XP_002974241.1; |
KEGG | smo:SELMODRAFT_414574; |
InterPro | IPR008949;IPR034686; |
Protein Sequence | MEDVLAEKLSRVCKFDLPFIPCSIPFECHPDFTRISKDTDAWALRMLSITDPYERKKALQGRHSLYSPMIIPRGESSKAELSSKHTWTMFVLDDIAENFSEQEGKKAIDILLEVAEGSYVLSEKEKEKHPSHAMFEEVMSSFRSLMDPPLFARYMNCLRNYLDSVVEEASLRIAKSIPSLEKYRLLRRETSFMEADGGIMCEFCMDLKLHKSVVESPDFVAFVKAVIDHVVLVNDLLSFRHELKIKCFHNYLCVIFCHSPDNTSFQETVDKVCEMIQEAEAEILQLQQKLIKLGEETGDKDLVEYATWYPCVASGNLRWSYVTGRYHGLDNPLLNGEPFQGTWFLHPEATLILPLGSKCGNHPFITI |
