| Entry | O65726 |
Entry Name | ERG12_BRANA |
| Sequence Status | reviewed |
| Protein Name | Squalene monooxygenase 1,2 (EC 1.14.14.17) (Squalene epoxidase 1,2) (SE 1,2) |
| Sequence Length | 518 |
| Gene Name | SQP1,2 |
| Organism | Brassica napus (Rape) |
| EC Number | 1.14.14.17 |
Protein Function | FUNCTION: Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway. {ECO:0000250|UniProtKB:Q9SM02}. |
Pathway | PATHWAY: Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 2/3. |
Protein Active Site | |
Reference | 10350086 |
Domain | |
Motif | |
Protein Family | Squalene monooxygenase family |
Ensembl ID | |
Biocyc ID | PF08491; |
Protein Existence | Evidence at transcript level |
Subunit Structure | |
Gene Ontology Biological Process | |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; flavin adenine dinucleotide binding [GO:0050660]; squalene monooxygenase activity [GO:0004506] |
Gene Ontology Molecular Function | flavin adenine dinucleotide binding [GO:0050660]; squalene monooxygenase activity [GO:0004506] |
GO ID | GO:0004506; GO:0016021; GO:0050660 |
String Database | |
PDB | |
RefSeq | NP_001302490.2; |
KEGG | bna:106415877; |
InterPro | IPR036188;IPR013698; |
Protein Sequence | MDMAFVEVCLRMLLVFVLSWTIFHVNNRKKKKATKLADLATEERKEGGPDVIIVGAGVGGSALAYALAKDGRRVHVIERDMREPVRMMGEFMQPGGRLMLSKLGLQDCLEEIDAQKSTGIRLFKDGKETVACFPVDTNFPYEPSGRFFHNGRFVQRLRQKASSLPNVRLEEGTVRSLIEEKGVVKGVTYKNSSGEETTSFAPLTVVCDGCHSNLRRSLNDNNAEVTAYEIGYISRNCRLEQPDKLHLIMAKPSFAMLYQVSSTDVRCNFELLSKNLPSVSNGEMTSFVRNSIAPQVPLKLRKTFLKGLDEGSHIKITQAKRIPATLSRKKGVIVLGDAFNMRHPVIASGMMVLLSDILILSRLLKPLGNLGDENKVSEVMKSFYALRKPMSATVNTLGNSFWQVLIASTDEAKEAMRQGCFDYLSSGGFRTSGLMALIGGMNPRPLSLFYHLFVISLSSIGQLLSPFPTPLRVWHSLRLLDLSLKMLVPHLKAEGIGQMLSPTNAAAYRKSYMAATVV |
