| Entry | A0A059CT23 |
Entry Name | A0A059CT23_EUCGR |
| Sequence Status | unreviewed |
| Protein Name | Uncharacterized protein |
| Sequence Length | 217 |
| Gene Name | EUGRSUZ_C02467 |
| Organism | Eucalyptus grandis (Flooded gum) |
| EC Number | |
Protein Function | |
Pathway | |
Protein Active Site | |
Reference | 24919147 |
Domain | |
Motif | |
Protein Family | |
Ensembl ID | |
Biocyc ID | PF03936; |
Protein Existence | Predicted |
Subunit Structure | |
Gene Ontology Biological Process | |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333] |
Gene Ontology Molecular Function | magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333] |
GO ID | GO:0000287; GO:0010333; GO:0016021 |
String Database | |
PDB | |
RefSeq | XP_010048735.1; |
KEGG | egr:104437474; |
InterPro | IPR008949;IPR005630; |
Protein Sequence | MQVCYKIVLDLYDEIGYEVTRKGRSNYLLYAKEAMKNQVRAYFTEAKWFHQNHIPMMEEYMPIALSTIAIELLLVMLLLLGMGDTVTKDVFDWLLYSKPKIVNAMKIVCRLMDDIAGHKFEQERGHGPSSMECFMKQYGVTEEEAKEELHKQVANAWKDINEGLCCSTNVPRQLLVRILNFTRVVHVVYKDEIDLYTHAGTKLKEHVTNLYVNPLPM |
