| Entry | A0A067DYX3 |
Entry Name | A0A067DYX3_CITSI |
| Sequence Status | unreviewed |
| Protein Name | Uncharacterized protein (Fragment) |
| Sequence Length | 151 |
| Gene Name | CISIN_1g0264851mg |
| Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
| EC Number | |
Protein Function | |
Pathway | |
Protein Active Site | |
Reference | |
Domain | |
Motif | |
Protein Family | |
Ensembl ID | |
Biocyc ID | PF13243; |
Protein Existence | Predicted |
Subunit Structure | |
Gene Ontology Biological Process | |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; intramolecular transferase activity [GO:0016866] |
Gene Ontology Molecular Function | intramolecular transferase activity [GO:0016866] |
GO ID | GO:0016021; GO:0016866 |
String Database | |
PDB | |
RefSeq | |
KEGG | |
InterPro | IPR032696;IPR002365;IPR008930; |
Protein Sequence | MTLFKKLYPKHRTKEVKNFIAKATKFIEDIQKSDGSWYGSWGICFTYAAWFAISGLVAAKKTYSNCLAIRKATDFLLKIQCEDGGWGESYRSCPNKKYIPLDGNRSNLVQTAWAMMSLIHAGQMERDPTPLHRAAKLLINSQLEDGDFPQQ |