| Entry | A0A067K285 |
Entry Name | A0A067K285_JATCU |
| Sequence Status | unreviewed |
| Protein Name | Uncharacterized protein |
| Sequence Length | 130 |
| Gene Name | JCGZ_23000 |
| Organism | Jatropha curcas (Barbados nut) |
| EC Number | |
Protein Function | |
Pathway | |
Protein Active Site | |
Reference | 24837971 |
Domain | |
Motif | |
Protein Family | Terpene synthase family |
Ensembl ID | |
Biocyc ID | PF01397; |
Protein Existence | Inferred from homology |
Subunit Structure | |
Gene Ontology Biological Process | metabolic process [GO:0008152] |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; terpene synthase activity [GO:0010333]; metabolic process [GO:0008152] |
Gene Ontology Molecular Function | terpene synthase activity [GO:0010333] |
GO ID | GO:0008152; GO:0010333; GO:0016021 |
String Database | |
PDB | |
RefSeq | |
KEGG | |
InterPro | IPR001906;IPR008930; |
Protein Sequence | MALQPVLSFPLATSRRSANYESTVWDYDVLQSLPSKHSEEKPTKQVEKLKNEDKSLINREMEPLAKLELIDEVQRLGLKYQFELEIKDALNAVYSNTIMVGHTMMIFMLLHFVLGYLDSMGIMHPKITGY |