| Entry | A0A151SUY7 |
Entry Name | A0A151SUY7_CAJCA |
| Sequence Status | unreviewed |
| Protein Name | Amorpha-4,11-diene synthase |
| Sequence Length | 227 |
| Gene Name | KK1_014002 |
| Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
| EC Number | |
Protein Function | |
Pathway | |
Protein Active Site | |
Reference | 22057054 |
Domain | |
Motif | |
Protein Family | |
Ensembl ID | |
Biocyc ID | PF03936; |
Protein Existence | Predicted |
Subunit Structure | |
Gene Ontology Biological Process | |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333] |
Gene Ontology Molecular Function | magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333] |
GO ID | GO:0000287; GO:0010333; GO:0016021 |
String Database | |
PDB | |
RefSeq | |
KEGG | |
InterPro | IPR008949;IPR005630; |
Protein Sequence | MVEVKWCYESYIPTYDEYKVNAVLSFTIPFFITLFIFLREFATENVLDWASRGPNIIEVASIIFDQQRIHIASIVECCMKQYDISQAHAYKLIHKDVEDCWKVINKIYFNLNDIPEPVLTTRISLITCNFSCEFFIKICRKRCSCKFFCEILFAGNTFVDNIFLRILKFAGNFPAKFPAKKIRRKVSCKKKFAGNFPAKKKSQENSQETFLRIFSQEILQEYFLRKN |