| Entry | D8RLD3 |
Entry Name | MTS17_SELML |
| Sequence Status | reviewed |
| Protein Name | (+)-germacrene D synthase (EC 4.2.3.77) (Microbial Terpene synthase-like protein 17) (SmMTPSL17) (EC 4.2.3.-) |
| Sequence Length | 348 |
| Gene Name | SELMODRAFT_412756 |
| Organism | Selaginella moellendorffii (Spikemoss) |
| EC Number | 4.2.3.77; 4.2.3.- |
Protein Function | FUNCTION: Sesquiterpene synthase converting farnesyl diphosphate to eight sesquiterpenes, with (+)-germacrene D and an unidentified oxygenated sesquiterpene as the major products. Has no diterpene synthase activity. {ECO:0000269|PubMed:22908266}. |
Pathway | PATHWAY: Secondary metabolite biosynthesis; terpenoid biosynthesis. |
Protein Active Site | |
Reference | 22908266; 21551031 |
Domain | DOMAIN: The Asp-Asp-Xaa-Xaa-Asp/Glu (DDXXD/E) motif is important for the catalytic activity, presumably through binding to Mg(2+). {ECO:0000250}. |
Motif | MOTIF 97 101 DDXXD motif. |
Protein Family | Terpene synthase family |
Ensembl ID | EFJ26899; |
Biocyc ID | PF03936; |
Protein Existence | Evidence at protein level |
Subunit Structure | |
Gene Ontology Biological Process | terpenoid biosynthetic process [GO:0016114] |
Gene Ontology Cellular Component | |
Gene Ontology | magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]; terpenoid biosynthetic process [GO:0016114] |
Gene Ontology Molecular Function | magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333] |
GO ID | GO:0000287; GO:0010333; GO:0016114 |
String Database | |
PDB | |
RefSeq | XP_002971982.1; |
KEGG | smo:SELMODRAFT_412756; |
InterPro | IPR008949;IPR034686;IPR005630; |
Protein Sequence | MAVSSIASIFAAEKSYSIPPVCQLLVSPVLNPLYDAKAESQIDAWCAEFLKLQPGSEKAVFVQESRLGLLAAYVYPTIPYEKIVPVGKFFASFFLADDILDSPEISSSDMRNVATAYKMVLKGRFDEATLPVKNPELLRQMKMLSEVLEELSLHVVDESGRFVDAMTRVLDMFEIESSWLRKQIIPNLDTYLWLREITSGVAPCFALIDGLLQLRLEERGVLDHPLIRKVEEIGTHHIALHNDLMSLRKEWATGNYLNAVPILASNRKCGLNEAIGKVASMLKDLEKDFARTKHEIISSGLAMKQGVMDYVNGIEVWMAGNVEWGWTSARYHGIGWIPPPEKSGTFQL |