Entry | F6HN23 |
Entry Name | F6HN23_VITVI |
Sequence Status | unreviewed |
Protein Name | Uncharacterized protein |
Sequence Length | 192 |
Gene Name | VIT_18s0001g05390 |
Organism | Vitis vinifera (Grape) |
EC Number | |
Protein Function | |
Pathway | |
Protein Active Site | |
Reference | 17721507 |
Domain | |
Motif | |
Protein Family | |
Ensembl ID | VIT_18s0001g05390.t01; |
Biocyc ID | PF03936; |
Protein Existence | Predicted |
Subunit Structure | |
Gene Ontology Biological Process | |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333] |
Gene Ontology Molecular Function | magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333] |
GO ID | GO:0000287; GO:0010333; GO:0016021 |
String Database | |
PDB | |
RefSeq | |
KEGG | |
InterPro | IPR008949;IPR005630; |
Protein Sequence | MHDAFQTGSLTGFRGQSFFFPPKACSMGHPHVLSEEYLSVALVTSDVTLFTIISFVGMGRRATKEVFDWVWNDPKIMKATSTIIRLMDDMASHEFEQQRGHAASSVECYMKQHGVSEQHAYQELNKQVENAWKDVNQGCLRPTAIPMHLLTRVLNFARAGDFMYGGGKDIFTNVGEVMNDNIASLFVHPVPI |