| Entry | J9R1J8 |
Entry Name | MTS1_SELML |
| Sequence Status | reviewed |
| Protein Name | Microbial Terpene synthase-like protein 1 (SmMTPSL1) (EC 4.2.3.-) |
| Sequence Length | 349 |
| Gene Name | SELMODRAFT_402353 |
| Organism | Selaginella moellendorffii (Spikemoss) |
| EC Number | 4.2.3.- |
Protein Function | FUNCTION: Sesquiterpene synthase converting farnesyl diphosphate to six sesquiterpenes, with beta-elemene, delta-cadinene and an unidentified oxygenated sesquiterpene as the major products. Has no diterpene synthase activity. {ECO:0000269|PubMed:22908266}. |
Pathway | PATHWAY: Secondary metabolite biosynthesis; terpenoid biosynthesis. |
Protein Active Site | |
Reference | 22908266; 21551031 |
Domain | DOMAIN: The Asp-Asp-Xaa-Xaa-Asp/Glu (DDXXD/E) motif is important for the catalytic activity, presumably through binding to Mg(2+). {ECO:0000250}. |
Motif | MOTIF 98 102 DDXXD motif. |
Protein Family | Terpene synthase family |
Ensembl ID | EFJ38437; |
Biocyc ID | PF03936; |
Protein Existence | Evidence at protein level |
Subunit Structure | |
Gene Ontology Biological Process | terpenoid biosynthetic process [GO:0016114] |
Gene Ontology Cellular Component | |
Gene Ontology | magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]; terpenoid biosynthetic process [GO:0016114] |
Gene Ontology Molecular Function | magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333] |
GO ID | GO:0000287; GO:0010333; GO:0016114 |
String Database | |
PDB | |
RefSeq | XP_002960898.1; |
KEGG | smo:SELMODRAFT_402353; |
InterPro | IPR008949;IPR034686;IPR005630; |
Protein Sequence | MAILSIVSIFAAEKSYSIPPASNKLLASPALNPLYDAKADAEINVWCDEFLKLQPGSEKSVFIRESRLGLLAAYAYPSISYEKIVPVAKFIAWLFLADDILDNPEISSSDMRNVATAYKMVFKGRFDEAALLVKNQELLRQVKMLSEVLKELSLHLVDKSGRFMNSMTKVLDMFEIESNWLHKQIVPNLDTYMWLREITSGVAPCFAMLDGLLQLGLEERGVLDHPLIRKVEEIGTHHIALHNDLISFRKEWAKGNYLNAVPILASIHKCGLNEAIAMLASMVEDLEKEFIGTKQEIISSGLARKQGVMDYVNGVEVWMAANAEWGWLSARYHGIGWIPPPEKSGTFQL |
