| Entry | Q5UB07 |
Entry Name | TPS4_MEDTR |
| Sequence Status | reviewed |
| Protein Name | Tricyclene synthase TPS4, chloroplastic (EC 4.2.3.105) ((E)-beta-ocimene synthase) (MtEBOS) (MtEbetaOS) (EC 4.2.3.106) (Terpenoid synthase 4) (MtTPS4) |
| Sequence Length | 580 |
| Gene Name | TPS4 |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| EC Number | 4.2.3.105; 4.2.3.106 |
Protein Function | FUNCTION: Promotes the emission of terpenes volatile organic compounds (VOC) in response to damage mediated by arthropod herbivores (e.g. Spodoptera exigua), probably to attract natural enemies of the herbivores. {ECO:0000269|PubMed:15660362, ECO:0000269|PubMed:19249223}. |
Pathway | PATHWAY: Secondary metabolite biosynthesis; terpenoid biosynthesis. |
Protein Active Site | |
Reference | 15660362; 19249223 |
Domain | DOMAIN: The Asp-Asp-Xaa-Xaa-Asp/Glu (DDXXD/E) motif is important for the catalytic activity, presumably through binding to Mg(2+). |
Motif | MOTIF 334 338 DDXXD motif. |
Protein Family | Terpene synthase family, Tpsb subfamily |
Ensembl ID | |
Biocyc ID | PF01397;PF03936; |
Protein Existence | Evidence at protein level |
Subunit Structure | |
Gene Ontology Biological Process | defense response [GO:0006952]; response to herbivore [GO:0080027]; response to jasmonic acid [GO:0009753]; response to wounding [GO:0009611]; terpenoid biosynthetic process [GO:0016114] |
Gene Ontology Cellular Component | chloroplast stroma [GO:0009570] |
Gene Ontology | chloroplast stroma [GO:0009570]; magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]; tricyclene synthase activity [GO:0102701]; defense response [GO:0006952]; response to herbivore [GO:0080027]; response to jasmonic acid [GO:0009753]; response to wounding [GO:0009611]; terpenoid biosynthetic process [GO:0016114] |
Gene Ontology Molecular Function | magnesium ion binding [GO:0000287]; terpene synthase activity [GO:0010333]; tricyclene synthase activity [GO:0102701] |
GO ID | GO:0000287; GO:0006952; GO:0009570; GO:0009611; GO:0009753; GO:0010333; GO:0016114; GO:0080027; GO:0102701 |
String Database | |
PDB | |
RefSeq | |
KEGG | ag:AAV36465; |
InterPro | IPR008949;IPR034741;IPR001906;IPR036965;IPR005630;IPR008930; |
Protein Sequence | MLLNSSFISLPSFFKSQELGRTNLLIHRNGSPLLCYATNTNVSQRKSANYQPNIWNYDILQSLKHDYEDARYVDRSRRLQEEVKRMIKDENVNILELIDTVKQLGLSYHFEEEIGEALDRFLSLEKCSGRNNFGRSLHETALRFRLLREYGYDISPDIFEKFKDHNGNFKACLVQDIKGMLSLYDASFLSYEGEQILDEANAFTSIHLKDLSEGRSSILIDQVNHSLELPLYRRVQSLEARWFIDSYENRKDANKVLLEAAKLNFNIVQSTLQQDLKEMSRWWKGMGLAPRLSFGRDRLMECFFWAAGMTPFEPQFSNIRKGLTKVCSLITLIDDIYDVYGTLDELELFTTAVESWDINAIQILPEYMKIFFLALYTTVNDFTYDTIKETGHDILPYLVKVWSDMLKAFLQEAKWCHNKHMPKFDDYLNNAWVSVSGVVLLTHSYFLLNRNITKEGLGYLENCPMLLQTPSIIFRLCNDLATSSAELERGEGANSIICYMNENGVSEEVAYKHIQNLLDQTWKKMNKDRVINSPSSKYFSETIINLARISHCTYQYGDGHGAPDTLAKNRIKALILEPIN |
