Entry | Q9C624 |
Entry Name | Q9C624_ARATH |
Sequence Status | unreviewed |
Protein Name | Lupeol synthase, 5' partial (Fragment) |
Sequence Length | 192 |
Gene Name | T4O24.6 |
Organism | Arabidopsis thaliana (Mouse-ear cress) |
EC Number | |
Protein Function | |
Pathway | |
Protein Active Site | |
Reference | |
Domain | |
Motif | |
Protein Family | |
Ensembl ID | |
Biocyc ID | PF13243; |
Protein Existence | Predicted |
Subunit Structure | |
Gene Ontology Biological Process | |
Gene Ontology Cellular Component | integral component of membrane [GO:0016021] |
Gene Ontology | integral component of membrane [GO:0016021]; intramolecular transferase activity [GO:0016866] |
Gene Ontology Molecular Function | intramolecular transferase activity [GO:0016866] |
GO ID | GO:0016021; GO:0016866 |
String Database | |
PDB | |
RefSeq | |
KEGG | |
InterPro | IPR032696;IPR002365;IPR008930; |
Protein Sequence | ALVIFNQLYPDHRTKEITKSIEKAVQFIESKQLRDGSWYGSWGICFTYGTWFALCGLAAIGKTYNNCLSMRDGVHFLLNIQNEDGGWGESYMSCPEQRYIPLEGNRSNVVQTAWAMMALIHAGQAKRDLIPLHSAAKFIITSQLENGDFPQQELLGASMSTCMLHYSTYKDIFPPWALAEYRKAAFIHHADL |